Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAV NHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYE NVPEEEGKVRSTPM
    • Amino acids
      1 to 114
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 17 kDa membrane associated protein
    • DD96
    • Epithelial protein up regulated in carcinoma membrane associated protein 17
    • Membrane associated protein 17
    • PDZK1-interacting protein 1
    • Pdzk1ip1
    • RP1-18D14.5
    • SPAP
    see all
  • Relevance
    MAP17 is a 17 kDa membrane-associated protein expressed abundantly in carcinomas arising from kidney, colon, lung, and breast. In normal tissues it is expressed in significant amounts in the kidney.
  • Cellular localization
    Plasma membrane

Images

  • ab160847 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up