Description

  • Product name

    Recombinant Human MAP1D protein (BSA and azide free)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHH SSGLVPRGSH MGSSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPK HIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLK VDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDS RPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDE AIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWH HANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEH TVLITSRGAQILTKLPHEA
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      20 to 335
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NP_954697.1)

Specifications

Our Abpromise guarantee covers the use of ab174389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.32% Tris-HCl buffer, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names

    • AMP1D_HUMAN
    • CDS of metAP 3 within PCR fragment
    • M ethionine aminopeptidase 1D, mitochondrial precursor
    • MAP 1D
    • MAP1D
    • MetAP 1D
    • Metap1l
    • Methionine aminopeptidase 1D
    • Methionine aminopeptidase 1D, mitochondrial
    • Methionyl aminopeptidase type 1D (mitochondrial)
    • Methionyl aminopeptidase type 1D, mitochondrial
    • mitochondrial
    • Peptidase M 1D
    see all
  • Function

    Removes the amino-terminal methionine from nascent proteins (By similarity). May play a role in colon tumorigenesis.
  • Tissue specificity

    Overexpressed in colon cancer cell lines and colon tumors as compared to normal tissues (at protein level).
  • Sequence similarities

    Belongs to the peptidase M24A family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • SDS-PAGE analysis MAP1D using 3 µg of ab174389 on a 15% gel.

References

ab174389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up