Recombinant Human MAP1D protein (BSA and azide free) (ab174389)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPK HIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLK VDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDS RPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDE AIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWH HANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEH TVLITSRGAQILTKLPHEA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      20 to 335
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_954697.1)

Specifications

Our Abpromise guarantee covers the use of ab174389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • AMP1D_HUMAN
    • CDS of metAP 3 within PCR fragment
    • M ethionine aminopeptidase 1D, mitochondrial precursor
    • MAP 1D
    • MAP1D
    • MetAP 1D
    • Metap1l
    • Methionine aminopeptidase 1D
    • Methionine aminopeptidase 1D, mitochondrial
    • Methionyl aminopeptidase type 1D (mitochondrial)
    • Methionyl aminopeptidase type 1D, mitochondrial
    • mitochondrial
    • Peptidase M 1D
    see all
  • Function
    Removes the amino-terminal methionine from nascent proteins (By similarity). May play a role in colon tumorigenesis.
  • Tissue specificity
    Overexpressed in colon cancer cell lines and colon tumors as compared to normal tissues (at protein level).
  • Sequence similarities
    Belongs to the peptidase M24A family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • SDS-PAGE analysis MAP1D using 3 µg of ab174389 on a 15% gel.

References

ab174389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up