Description

  • Product name

    Recombinant Human MAP1LC3B2 protein
  • Purity

    > 95 % SDS-PAGE.
    ab106858 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTK IPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 120
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • ATG8G
    • MAP1LC3B2
    • Microtubule associated protein 1 light chain 3 beta 2
    • Microtubule associated proteins 1A/1B light chain 3B like protein
    • Microtubule-associated proteins 1A/1B light chain 3 beta 2
    • Microtubule-associated proteins 1A/1B light chain 3B-like
    • MP3B2_HUMAN
    see all
  • Function

    Probably involved in formation of autophagosomal vacuoles (autophagosomes).
  • Sequence similarities

    Belongs to the MAP1 LC3 family.
  • Post-translational
    modifications

    The precursor molecule is cleaved by APG4B/ATG4B to form LC3-I (By similarity). This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form LC3-II.
  • Cellular localization

    Cytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab106858.

References

ab106858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up