Recombinant Human MAP1S protein (ab163011)

Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVI SGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE
    • Amino acids

      929 to 1026
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BPY2-interacting protein 1
    • BPY2IP1
    • C19orf5
    • FLJ10669
    • MAP-1S
    • MAP1S
    • MAP1S light chain
    • MAP1S_HUMAN
    • MAP8
    • MGC133087
    • microtubule-associated protein 1S
    • Microtubule-associated protein 8
    • Variable charge Y chromosome 2-interacting protein 1
    • VCY2-interacting protein 1
    • VCY2IP-1
    • VCY2IP1
    see all
  • Function

    Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule-organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles.
  • Tissue specificity

    Expressed in neurons (at protein level). Expressed in spermatocytes, spermatids and spermatozoa. Expressed in the cerebral cortex. Highly expressed in testis. Moderately expressed in the brain, colon, heart, kidney, liver, lung, placenta, small intestine, spleen and stomach. Weakly expressed in muscle.
  • Sequence similarities

    Belongs to the MAP1 family.
  • Domain

    The N-terminus of the heavy chain associates with the C-terminus of the light chain to form the heterodimer complex (By similarity). Its C-terminal part of the heavy chain interacts with ESR1.
  • Cellular localization

    Nucleus. Cytoplasm > cytosol. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > spindle. Detected in filopodia-like protrusions and synapses (By similarity). Detected in perinuclear punctate network corresponding to mitochondrial aggregates and in the nucleus in cells exhibiting apoptosis. Associated specifically with microtubules stabilized by paclitaxel and colocalizes with RASSF1 isoform A. In interphase cells, shows a diffuse cytoplasmic staining with partial localization to the microtubules. During the different stages of mitosis detected at the spindle microtubules.
  • Information by UniProt

Images

  • ab163011 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up