Description

  • Product name

    Recombinant Human MAP2K1IP1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab102022 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMADDLKRFLYKKLPSVEGLHAIVVSDRDGV PVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQV VQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 124
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.077% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • LAMTOR3
    • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3
    • LTOR3_HUMAN
    • MAP2K1IP1
    • MEK binding partner 1
    • MEK partner 1
    • MEK-binding partner 1
    • Mitogen activated protein kinase kinase 1 interacting protein 1
    • Mitogen-activated protein kinase kinase 1-interacting protein 1
    • Mitogen-activated protein kinase scaffold protein 1
    • Mp1
    • Ragulator complex protein LAMTOR3
    see all
  • Function

    As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
  • Sequence similarities

    Belongs to the LAMTOR3 family.
  • Cellular localization

    Late endosome membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab102022.

References

ab102022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up