Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEG YTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD
    • Amino acids
      691 to 786
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis signal-regulating kinase 3
    • ASK3
    • bA723P2.3
    • FLJ16518
    • M3K15_HUMAN
    • Map3k15
    • MAPK/ERK kinase kinase 15
    • MEK kinase 15
    • MEKK 15
    • Mitogen activated protein kinase kinase kinase 15
    • Mitogen-activated protein kinase kinase kinase 15
    • OTTHUMP00000183504
    see all
  • Function
    May function in a signal transduction pathway that is activated by various cell stresses and leads to apoptosis.
  • Tissue specificity
    Isoform 2 and isoform 3 are widely expressed. Isoform 2 highest levels are observed in fetal brain, and isoform 3 highest levels in pancreas, peripheral blood leukocytes, fetal brain and spleen.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab166430 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up