Recombinant human MAP4K3 protein (Tagged) (ab177265)

Overview

  • Product name
    Recombinant human MAP4K3 protein (Tagged)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLE PGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQD IYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHV KLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAV GITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFV KMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDF DDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHH ELPDSDGFLD SSEEIYYTARSNLDLQLEYG
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 380
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    92 nmol/min/mg

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 70 % Densitometry.

  • Form
    Liquid
  • Additional notes

    ab204848 (c Abl peptide) can be utilized as a substrate for assessing Kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Germinal center kinase like kinase
    • Germinal center kinase-related protein kinase
    • GLK
    • MAPK/ERK kinase kinase kinase 3
    • MAPKKKK3
    • MEK kinase kinase 3
    • MEKKK 3
    • MEKKK3
    • mitogen-activated protein kinase kinase kinase kinase 3
    • RAB8IPL1
    see all
  • Relevance
    May play a role in the response to environmental stress. This gene encodes a member of the Ste20 family of serine/threonine protein kinases. The protein belongs to the subfamily that consists of members, such as germinal center kinase (GCK), that are characterized by an N-terminal catalytic domain and C-terminal regulatory domain. The protein specifically activates the c-Jun N-terminal kinase (JNK) signaling pathway.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • The specific activity of ab177265 was determined to be 92 nmol/min/mg.

     

  • SDS-PAGE analysis of ab177265.

References

ab177265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up