Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIF CEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPI TDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQ QQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNE FLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFY VINYLVRLSFHNLKFDCSTANKIFLRTN
    • Amino acids
      1 to 278
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.7.11.1
    • KHS
    • Kinase homologous to SPS1/STE20
    • MAPK/ERK kinase kinase kinase 5
    • MEK kinase kinase 5
    • MEKKK 5
    see all
  • Relevance
    MAP4K5, a member of the STE20 subfamily of Ser/Thr protein kinases, may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K5 interacts with both SH3 domains of the adapter proteins CRK and CRKL. This cytoplasmic protein is ubiquitously expressed in all tissues examined, with high levels in the ovary, testis and prostate.
  • Cellular localization
    Cytoplasmic

Images

  • ab161340 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161340 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up