Overview

  • Product name

    Recombinant Human MAPK4 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDL QGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIH SANVLHRDLK
    • Amino acids

      42 to 151
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ERK-4
    • ERK3
    • Erk3 related
    • ERK4
    • Extracellular signal regulated kinase 4
    • Extracellular signal-regulated kinase 4
    • MAP kinase 4
    • MAP kinase isoform p63
    • MAPK 4
    • MAPK4
    • Mitogen activated protein kinase 4
    • Mitogen-activated protein kinase 4
    • MK04_HUMAN
    • p63 MAPK
    • p63-MAPK
    • p63MAPK
    • PRKM4
    • Protein kinase, mitogen-activated, 4
    • Protein-tyrosine kinase ERK3-related
    • RMNK2
    see all
  • Function

    Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK4/MAPK4 is phosphorylated at Ser-186 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK4/MAPK4. May promote entry in the cell cycle.
  • Tissue specificity

    High expression in heart and brain.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The FRIEDE motif is required for docking MAPKAPK5.
    In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Phosphorylated at Ser-186 by PAK1, PAK2 and PAK3 resulting in catalytic activation. Phosphorylated by MAPKAPK5 at other sites.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates to the cytoplasm following interaction with MAPKAPK5.
  • Information by UniProt

Images

  • ab159216 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up