Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKK IVLTDPQSVKHALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTE LNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLH RDLKPANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSP RLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESIPV VHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSH IYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRK YLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTCNYKTRS SSYLDNLVWRESEVNHYYEPKLIIDLSNWKEQSKEKSDKKGKSKCERNGL VKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQHEPTDVVDKL NDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG GEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDG KLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPS AMKSSPQIPHQTYSSILKHLN
    • Amino acids

      1 to 721
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as MAPK6.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ERK-3
    • ERK3
    • Extracellular signal regulated kinase 3
    • Extracellular signal regulated kinase p97
    • Extracellular signal-regulated kinase 3
    • HsT17250
    • MAP kinase 6
    • MAP kinase isoform p97
    • MAPK 6
    • MAPK6
    • Mitogen activated protein kinase 6
    • Mitogen-activated protein kinase 6
    • MK06_HUMAN
    • p97 MAPK
    • p97-MAPK
    • PRKM6
    • Protein kinase mitogen activated 5
    • Protein kinase mitogen activated 6
    see all
  • Function

    Phosphorylates microtubule-associated protein 2 (MAP2). May promote entry in the cell cycle.
  • Tissue specificity

    Highest expression in the skeletal muscle, followed by the brain. Also found in heart, placenta, lung, liver, pancreas, kidney and skin fibroblasts.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Dually phosphorylated on Thr-626 and Tyr-628, which activates the enzyme.
  • Information by UniProt

Images

  • ab159217 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up