Overview

  • Product name

    Recombinant Human MAPRE1/EB1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFAVNVYSTSVTSDNLSRHDMLA WINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYI QNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGK DYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAA PKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLR NIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
    • Molecular weight

      33 kDa including tags
    • Amino acids

      2 to 268
    • Additional sequence information

      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal (NP_036457.1).

Specifications

Our Abpromise guarantee covers the use of ab182821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab182821 was expressed in E.coli as inclusion bodies, refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as MAPRE1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.0
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, Arginine, DTT and Glycerol.

General Info

  • Alternative names

    • 5530600P05Rik
    • Adenomatous polyposis coli binding protein EB 1
    • Adenomatous polyposis coli binding protein EB1
    • AI462499
    • AI504412
    • APC binding protein EB 1
    • APC binding protein EB1
    • APC-binding protein EB1
    • AW260097
    • BIM1p
    • D2Ertd459e
    • EB 1
    • EB1
    • End binding protein 1
    • End-binding protein 1
    • fa01e12
    • fc23e11
    • fi33c06
    • MAPRE 1
    • MAPRE1
    • Mapre3
    • MARE1_HUMAN
    • MGC117374
    • MGC129946
    • MGC52508
    • Microtubule associated protein RP/EB family member 1
    • Microtubule-associated protein RP/EB family member 1
    • wu:fa01e12
    • wu:fc23e11
    • wu:fi33c06
    • zgc:55428
    • zgc:77807
    • zgc:85755
    see all
  • Function

    May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the MAPRE family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 EB1 C-terminal domain.
  • Domain

    Composed of two functionally independent domains. The N-terminal domain forms an hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Associated with the microtubule network at the growing distal tip of microtubules. Also enriched at the centrosome.
  • Information by UniProt

References

ab182821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up