Description

  • Product name

    Recombinant Human Marapsin1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPV CLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNL LYSKDTEFGY
    • Amino acids

      94 to 203
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAPH2
    • Channel activating protease 2
    • Marapsin
    • MPN
    • Pancreasin
    • Protease serine 27
    • PRS27_HUMAN
    • Prss27
    • Serine protease 27
    • UNQ1884/PRO4327
    see all
  • Tissue specificity

    Expressed predominantly in the pancreas.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab164456 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up