Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSSHVCCNFLNMWKKSKISTMYYLNQDAKLSNLFLQASSPTTGTAPRSQ SRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIK
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp564M1682
    • E3 ubiquitin protein ligase MARCH1
    • E3 ubiquitin-protein ligase MARCH1
    • FLJ20668
    • MARCH 1
    • MARCH-I
    • March1
    • MARH1_HUMAN
    • Membrane associated RING CH protein I
    • Membrane associated ring finger (C3HC4) 1
    • Membrane associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase
    • Membrane associated RING finger protein 1
    • Membrane-associated RING finger protein 1
    • Membrane-associated RING-CH protein I
    • RING finger protein 171
    • RNF171
    see all
  • Function
    E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, downregulates their cell surface localization thus sequestering them in the intracellular endosomal system.
  • Tissue specificity
    Expressed in antigen presenting cells, APCs, located in lymph nodes and spleen. Also expressed in lung. Expression is high in follicular B cells, moderate in dendritic cells and low in splenic T cells.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-CH-type zinc finger.
  • Developmental stage
    During maturation of dendritic cells, expression is down-regulated and stabilizes MHC class II proteins accumulate at the plasma membrane.
  • Domain
    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Post-translational
    modifications
    Has a short half-life. Instability/short half-life permits rapid changes that allow efficient induction of antigen presentation once antigen presenting cells, APCs, receive maturation signals. Small changes in protein levels significantly alter the cell surface display of MHC class II proteins.
  • Cellular localization
    Golgi apparatus > trans-Golgi network membrane. Lysosome membrane. Cytoplasmic vesicle membrane. Late endosome membrane. Early endosome membrane. Cell membrane.
  • Information by UniProt

Images

  • ab162931 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up