Description

  • Product name

    Recombinant Human MARCH2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLST VIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSS SNTSYCELCHTEFAVEKRPRPLTEVSFRYHCQLYSEWRKTNQKVRLKIRE ADSPEGPQHSPLAAGLLKKVAEETPV
    • Amino acids

      1 to 176
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin protein ligase MARCH2
    • E3 ubiquitin-protein ligase MARCH2
    • EC 6.3.2.-
    • HSPC240
    • MARCH 2
    • MARCH II
    • MARCH-II
    • march2
    • MARH2_HUMAN
    • Membrane associated RING CH protein II
    • Membrane associated ring finger (C3HC4) 2
    • Membrane associated RING finger protein 2
    • Membrane-associated RING finger protein 2
    • Membrane-associated RING-CH protein II
    • RING finger protein 172
    • RNF172
    see all
  • Function

    E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
  • Tissue specificity

    Broadly expressed.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-CH-type zinc finger.
  • Domain

    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Endoplasmic reticulum membrane. Lysosome membrane. Endosome membrane.
  • Information by UniProt

Images

  • ab162472 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up