Overview

  • Product name
    Recombinant Human MARCH4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSG PLSHHHCAYTILHILSHLRPHEQRSPPGSSRELVMRVTTV
    • Amino acids
      321 to 410
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC056494
    • E3 ubiquitin protein ligase MARCH4
    • KIAA1399
    • MARCH 4
    • MARCH IV
    • Membrane associated RING CH protein IV
    • Membrane associated ring finger (C3HC4) 4
    • Membrane associated RING finger protein 4
    • MGC104908
    • mKIAA1399
    • RING finger protein 174
    • RNF174
    see all
  • Relevance
    MARCH4, an E3 ubiquitin protein ligase, may mediate ubiquitination of MHC I and CD4, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin protein ligases accept ubiquitin from an E2 ubiquitin conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Cellular localization
    Golgi apparatus membrane; Multipass membrane protein.

Images

  • ab163594 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up