Overview

  • Product name

    Recombinant Human MARCH5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRW VDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFA AAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPLFLLIGLPTIP VMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEANPL ADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTILGGIAFVAIKG AFKVYFKQQQYLRQAHRKILNYPEQEEA
    • Molecular weight

      58 kDa including tags
    • Amino acids

      1 to 278

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin-protein ligase MARCH5
    • FLJ20445
    • MARCH-V
    • MARCH5
    • MARH5_HUMAN
    • Membrane-associated ring finger (C3HC4) 5
    • Membrane-associated RING finger protein 5
    • Membrane-associated RING-CH protein V
    • Mitochondrial ubiquitin ligase
    • MITOL
    • RING finger protein 153
    • RNF153
    see all
  • Function

    Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control. Promotes ubiquitination of FIS1, DNM1L and MFN1.
  • Tissue specificity

    Expressed in brain, heart, liver, lung, spleen, stomach, testis, skeletal and muscle.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-CH-type zinc finger.
  • Domain

    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Post-translational
    modifications

    Autoubiquitinated leading to degradation (short half-life).
  • Cellular localization

    Mitochondrion outer membrane. Endoplasmic reticulum membrane. Authors show that the protein can be detected in endoplasmic reticulum (PubMed:14722266). Authors (PubMed:16874301) show its presence only in mitochondria.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132865 stained with Coomassie Blue.

References

ab132865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up