Overview

  • Product name

    Recombinant Human MARCH8/MIR protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS KAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCT GSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSS ERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTK LVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIF EKSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGAEIIHV
    • Amino acids

      1 to 291
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as MARCH8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • c MIR
    • c-MIR
    • Cellular modulator of immune recognition
    • E3 ubiquitin protein ligase MARCH8
    • E3 ubiquitin-protein ligase MARCH8
    • MARCH 8
    • MARCH VIII
    • MARCH-VIII
    • MARCH8
    • MARH8_HUMAN
    • Membrane associated RING CH protein VIII
    • Membrane associated ring finger (C3HC4) 8
    • Membrane associated RING finger protein 8
    • Membrane-associated RING finger protein 8
    • Membrane-associated RING-CH protein VIII
    • MIR
    • OTTHUMP00000058921
    • RING finger protein 178
    • RNF178
    see all
  • Function

    E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
  • Tissue specificity

    Broadly expressed. Present in immature dendritic cells (at protein level).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-CH-type zinc finger.
  • Domain

    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Cytoplasmic vesicle membrane. Lysosome membrane. Early endosome membrane.
  • Information by UniProt

Images

  • ab165955 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up