Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRT GPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREV VMRVTT
    • Amino acids
      240 to 345
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC019560
    • E3 ubiquitin protein ligase MARCH9
    • FLJ36578
    • MARCH IX
    • Membrane associated RING CH protein IX
    • membrane associated ring finger (C3HC4) 9
    • Membrane associated RING finger protein 9
    • RING finger protein 179
    • RNF179
    see all
  • Relevance
    MARCH9 (membrane-associated RING-CH protein IX) belongs to MARCH family, which contains at least seven membrane-associated RING-CH (MARCH)proteins. All MARCH proteins are ubiquitin ligases and located to subcellular membranes, and several MARCH proteins reduce surface levels of known substrates of the viral K3 family. Two closely related proteins, MARCH-IV and MARCH-IX, reduce surface expression of MHC-I molecules. In the presence of MARCH-IV or MARCH-IX, MHC-I are ubiquitinated and rapidly internalized by endocytosis. The functional similarity of the MARCH family and the K3 family of viral immune evasion proteins suggests that the viral immune evasion proteins were derived from MARCH proteins, a novel family of transmembrane ubiquitin ligases that seems to target glycoproteins for lysosomal destruction via ubiquitination of the cytoplasmic tail.
  • Cellular localization
    Golgi apparatus membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Images

  • ab164929 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up