Recombinant Human MARCKS like protein (ab156359)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMGSQSSKAPRGDVTAEEAAGASPAKAN GQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAK GEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQE QGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPS TPSGPESGPTPASAEQNE
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 195
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156359 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • F52
    • Mac MARCKS
    • Mac-MARCKS
    • MacMARCKS
    • Macrophage enriched Myristoylated Alanine Rich C Kinase Substrate Like Protein
    • Macrophage myristoylated alanine-rich C kinase substrate
    • MARCKS like 1
    • MARCKS like protein 1
    • MARCKS related protein
    • MARCKS-like protein 1
    • MARCKS-related protein
    • MARCKSL1
    • MLP
    • MLP1
    • MRP
    • MRP_HUMAN
    see all
  • Function
    May be involved in coupling the protein kinase C and calmodulin signal transduction systems.
  • Sequence similarities
    Belongs to the MARCKS family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab156359.

References

ab156359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up