Recombinant Human MARCKS like protein (ab163921)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPP VNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKL SGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPE SQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
    • Amino acids
      1 to 195
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F52
    • Mac MARCKS
    • Mac-MARCKS
    • MacMARCKS
    • Macrophage enriched Myristoylated Alanine Rich C Kinase Substrate Like Protein
    • Macrophage myristoylated alanine-rich C kinase substrate
    • MARCKS like 1
    • MARCKS like protein 1
    • MARCKS related protein
    • MARCKS-like protein 1
    • MARCKS-related protein
    • MARCKSL1
    • MLP
    • MLP1
    • MRP
    • MRP_HUMAN
    see all
  • Function
    May be involved in coupling the protein kinase C and calmodulin signal transduction systems.
  • Sequence similarities
    Belongs to the MARCKS family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab163921 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up