Description

  • Product name

    Recombinant Human Mare protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LLPSGDSPLNQRMTENLLASLSEHERAAILSVPAAQNPEDLRMFARLLHY FRGRHHLEEIMYNENTRRSQLLMLFDKFRSVLVVTTHEDPVIAVFQALL
    • Amino acids

      470 to 568
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as NPRL3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • -14 gene protein
    • Alpha-globin regulatory element-containing gene protein
    • C16ORF35
    • CGTHBA
    • Conserved gene telomeric to alpha globin cluster
    • HS 40
    • MARE
    • Nitrogen permease regulator 3-like protein
    • Nitrogen permease regulator-like 3 (S. cerevisiae)
    • NPR3
    • NPRL3
    • NPRL3_HUMAN
    • Protein CGTHBA
    • RMD11
    see all
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the NPR3 family.
  • Information by UniProt

Images

  • ab159949 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up