Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      STSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVP PRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
    • Amino acids
      246 to 337
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Atoh 2
    • Atoh2
    • Atonal homolog 2
    • Atonal protein homolog 2
    • Atonal protein homolog2
    • bHLH a2
    • bHLHa 2
    • bHLHa2
    • Class A basic helix-loop-helix protein 2
    • Helix loop helix protein mATH 2
    • Helix loop helix protein mATH2
    • MATH 2
    • Math2
    • NDF 6
    • NDF6
    • NDF6_HUMAN
    • Neuro D6
    • NeuroD6
    • Neurogenic differentiation 6
    • Neurogenic differentiation factor 6
    • Nex
    • Nex 1
    • Nex 1m
    • Nex1
    • Nex1 m
    • Nex1m
    • Protein atonal homolog 2
    • Protein atonal homolog2
    see all
  • Function
    Activates E box-dependent transcription in collaboration with TCF3/E47. May be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. Transactivates the promoter of its own gene.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163763 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up