Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPG TQCITKCEHTRPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLL
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CHK
    • Csk homologous kinase
    • Csk type protein tyrosine kinase
    • CTK
    • DKFZp434N1212
    • EC 2.7.10.2
    • Hematopoietic consensus tyrosine lacking kinase
    • Hematopoietic consensus tyrosine-lacking kinase
    • HHYLTK
    • Hydroxyaryl protein kinase
    • HYL
    • HYL tyrosine kinase
    • HYLTK
    • Leukocyte carboxyl terminal src kinase related
    • Lsk
    • matK
    • MATK_HUMAN
    • Megakaryocyte associated tyrosine kinase
    • Megakaryocyte associated tyrosine protein kinase
    • Megakaryocyte-associated tyrosine-protein kinase
    • MGC1708
    • MGC2101
    • Protein kinase HYL
    • Tyrosine kinase MATK
    • Tyrosine protein kinase CTK
    • Tyrosine-protein kinase CTK
    • Tyrosylprotein kinase
    see all
  • Function

    Could play a significant role in the signal transduction of hematopoietic cells. May regulate tyrosine kinase activity of SRC-family members in brain by specifically phosphorylating their C-terminal regulatory tyrosine residue which acts as a negative regulatory site. It may play an inhibitory role in the control of T-cell proliferation.
  • Tissue specificity

    Expressed in various myeloid cell lines, detected in brain and lung.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSK subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab158862 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up