Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPG TQCITKCEHTRPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLL AAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESA RHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDK GAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVL QGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGL YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGK FTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCP GPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGST SPRSQEP
    • Molecular weight
      83 kDa including tags
    • Amino acids
      1 to 507
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of MATK was determined to be 11 nmol /min/mg as per activity assay protocol.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 85 % Densitometry.

  • Form
    Liquid
  • Additional notes

    ab204877 (Poly (4:1 Glu, Tyr) peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CHK
    • Csk homologous kinase
    • Csk type protein tyrosine kinase
    • CTK
    • DKFZp434N1212
    • EC 2.7.10.2
    • Hematopoietic consensus tyrosine lacking kinase
    • Hematopoietic consensus tyrosine-lacking kinase
    • HHYLTK
    • Hydroxyaryl protein kinase
    • HYL
    • HYL tyrosine kinase
    • HYLTK
    • Leukocyte carboxyl terminal src kinase related
    • Lsk
    • matK
    • MATK_HUMAN
    • Megakaryocyte associated tyrosine kinase
    • Megakaryocyte associated tyrosine protein kinase
    • Megakaryocyte-associated tyrosine-protein kinase
    • MGC1708
    • MGC2101
    • Protein kinase HYL
    • Tyrosine kinase MATK
    • Tyrosine protein kinase CTK
    • Tyrosine-protein kinase CTK
    • Tyrosylprotein kinase
    see all
  • Function
    Could play a significant role in the signal transduction of hematopoietic cells. May regulate tyrosine kinase activity of SRC-family members in brain by specifically phosphorylating their C-terminal regulatory tyrosine residue which acts as a negative regulatory site. It may play an inhibitory role in the control of T-cell proliferation.
  • Tissue specificity
    Expressed in various myeloid cell lines, detected in brain and lung.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSK subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • The specific activity of ab204136 was determined to be 11 nmol /min/mg.

  • SDS-PAGE showing ab204136.

References

ab204136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up