Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWA VLYHTEDTRDQNQQVLNWRDGDTSLYPCQVCEPVPNCPCPRG
    • Molecular weight

      36 kDa including tags
    • Amino acids

      39 to 130

Specifications

Our Abpromise guarantee covers the use of ab152489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as Maxi Potassium channel beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BK channel beta subunit
    • BK channel subunit beta 1
    • BK channel subunit beta-1
    • BKbeta
    • BKbeta1
    • Calcium activated potassium channel subfamily M subunit beta 1
    • Calcium activated potassium channel subunit beta
    • Calcium activated potassium channel subunit beta 1
    • Calcium-activated potassium channel
    • Calcium-activated potassium channel subunit beta
    • Calcium-activated potassium channel subunit beta-1
    • Charybdotoxin receptor subunit beta 1
    • Charybdotoxin receptor subunit beta-1
    • Hbeta1
    • hslo beta
    • K(VCA)beta
    • K(VCA)beta 1
    • K(VCA)beta-1
    • KCMB1_HUMAN
    • KCNMB 1
    • Kcnmb1
    • Large conductance Ca2+ activated K+ channel beta 1 subunit
    • Maxi K channel beta subunit
    • Maxi K channel subunit beta 1
    • Maxi K channel subunit beta-1
    • Potassium large conductance calcium activated channel subfamily M beta member 1
    • SLO beta
    • Slo beta 1
    • Slo-beta
    • Slo-beta-1
    • subfamily M subunit beta-1
    see all
  • Function

    Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.
  • Tissue specificity

    Abundantly expressed in smooth muscle. Low levels of expression in most other tissues. Within the brain, relatively high levels found in hippocampus and corpus callosum.
  • Sequence similarities

    Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152489 stained with Coomassie Blue.

References

ab152489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up