Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGAS SPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
    • Molecular weight

      36 kDa including tags
    • Amino acids

      415 to 508

Specifications

Our Abpromise guarantee covers the use of ab152513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CXXC 3
    • CXXC-type zinc finger protein 3
    • CXXC3
    • MBD 1
    • Mbd1
    • MBD1_HUMAN
    • MECP1 COMPLEX
    • Methyl CpG binding domain protein 1
    • Methyl CpG binding domain protein 1 isoform PCM1
    • Methyl CpG binding protein MBD1
    • Methyl CpG binding protein splice variant 1
    • Methyl CpG binding protein splice variant 2
    • Methyl CpG binding protein splice variant 3
    • Methyl CpG binding protein splice variant 4
    • Methyl-CpG-binding domain protein 1
    • Methyl-CpG-binding protein MBD1
    • PCM 1
    • PCM1
    • Protein containing methyl-CpG-binding domain 1
    • Regulator of fibroblast growth factor 2 (FGF 2) transcription
    • RFT
    • The regulator of fibroblast growth factor 2(FGF 2) transcription
    see all
  • Function

    Transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binding is abolished by the presence of 7-mG that is produced by DNA damage by methylmethanesulfonate (MMS). Acts as transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Probably forms a complex with SETDB1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Isoform 1 and isoform 2 can also repress transcription from unmethylated promoters.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 3 CXXC-type zinc fingers.
    Contains 1 MBD (methyl-CpG-binding) domain.
  • Domain

    The methyl-CpG-binding domain (MBD) functions both in binding to methylated DNA and in protein interactions.
    The third CXXC-type zinc finger mediates binding to non-methylated CpG dinucleotides.
    The transcriptional repression domain (TRD) is involved in transcription repression and in protein interactions.
  • Post-translational
    modifications

    Sumoylated with SUMO1 by PIAS1 and PIAS3. Sumoylation affects transcriptional silencing by preventing the interaction with SETDB1. In contrast, sumoylation may increase interaction with AFT7IP.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus speckle. Chromosome. Nuclear, in a punctate pattern. Associated with euchromatic regions of the chromosomes, with pericentromeric regions on chromosome 1 and with telomeric regions from several chromosomes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152513 stained with Coomassie Blue.

References

ab152513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.

The binding with methylated DNA is related to the peptide ab4918.Please chek this is not a prtoein it is a blocking peptide whihc was used to producty antibody ab2846. This is not a fucntional peptide.

The other proteins are full length (ab152513) is full length protein whih chas been tested in WB, SDS-PAGE and ELISA. These applicaiotn doe snot involve any kind of binding with DNA so I am sorry we will not be able to comment on the binding specificity of this protein.

We unfortunaltely do not have Biotin conjugated proteins avialable.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up