Description

  • Product name

    Recombinant Human MBD3L1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEV RYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSY TGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVT EEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGCPEKR
    • Amino acids

      1 to 194
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MB3L1_HUMAN
    • MBD3 like 1
    • MBD3-like protein 1
    • MBD3L
    • Mbd3l1
    • Methyl CpG binding domain protein 3 like 1
    • Methyl-CpG-binding domain protein 3-like 1
    see all
  • Function

    Transcriptional repressor.
  • Tissue specificity

    Highly expressed in testis. Detected at low levels in pancreas. Not detected in the other tissues tested.
  • Sequence similarities

    Belongs to the MBD3L family.
  • Domain

    The N-terminal half of the protein mediates transcription repression.
  • Cellular localization

    Nucleus. Nuclear, in large foci.
  • Information by UniProt

Images

  • ab164770 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up