Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAE LVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCR YAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAH HQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTN LQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAP TTGNQLKF
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A530038J18Rik
    • AI661274
    • CHCR
    • Cys3His CCG1 required protein
    • Cys3His CCG1-required protein
    • E430034C16Rik
    • MBLX
    • MBLX39
    • MBNL 3
    • Mbnl3
    • MBNL3_HUMAN
    • MBXL
    • Muscleblind like 3
    • Muscleblind like protein 3
    • Muscleblind like splicing regulator 3
    • Muscleblind like X linked protein
    • Muscleblind-like protein 3
    • Muscleblind-like X-linked protein
    • OTTMUSP00000019072
    • OTTMUSP00000019073
    • OTTMUSP00000019074
    • Protein HCHCR
    • RP23-98P13.1
    see all
  • Function
    Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. May play a role in myotonic dystrophy pathophysiology (DM). Could inhibit terminal muscle differentiation, acting at approximately the time of myogenin induction.
  • Tissue specificity
    Highly expressed in the placenta.
  • Sequence similarities
    Belongs to the muscleblind family.
    Contains 4 C3H1-type zinc fingers.
  • Cellular localization
    Nucleus. Cytoplasm. Greater concentration in the nucleus. In both DM1 and DM2 patients, colocalizes with nuclear foci of retained expanded-repeat transcripts.
  • Information by UniProt

Images

  • ab163227 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up