Description

  • Product name

    Recombinant Human MBOAT2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEET QYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASW PTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLI SNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTSFSPTIQTFILSA IWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFIEPSQLKLFYDVITWI VTQVAISYTVVPFVLLSIKPSLTFYSSWYYCLHILGILVLLLLPVKKTQR RKNTHENIQLSQSKKFDEGENSLGQNSFSTTNNVCNQNQEIASRHSSLKQ
    • Amino acids

      1 to 350
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1-acylglycerophosphate O-acyltransferase
    • 1-acylglycerophosphoethanolamine O-acyltransferase
    • LPAAT
    • LPCAT4
    • LPEAT
    • LPLAT 2
    • Lyso-PA acyltransferase
    • Lyso-PE acyltransferase
    • Lysophosphatidic acid acyltransferase
    • Lysophosphatidylethanolamine acyltransferase
    • Lysophospholipid acyltransferase 2
    • MBOA2_HUMAN
    • Mboat2
    • Membrane bound O acyltransferase domain containing 2
    • Membrane-bound O-acyltransferase domain-containing protein 2
    • O acyltransferase (membrane bound) domain containing 2
    • O-acyltransferase domain-containing protein 2
    • OACT2
    see all
  • Function

    Acyltransferase which mediates the conversion of lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidic acid (LPA) into phosphatidic acid (PA) (LPAAT activity). Has also a very weak lysophosphatidylcholine acyltransferase (LPCAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
  • Tissue specificity

    Expressed in neutrophils.
  • Pathway

    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities

    Belongs to the membrane-bound acyltransferase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab165316 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up