Overview

  • Product name
    Recombinant Human MC2-R protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVF KNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFET TADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVV LTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLA RSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPY CACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
    • Molecular weight
      60 kDa including tags
    • Amino acids
      1 to 297

Specifications

Our Abpromise guarantee covers the use of ab152516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as MC2 receptor.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACTH receptor
    • ACTH-R
    • ACTHR
    • ACTHR_HUMAN
    • Adrenocorticotropic hormone receptor
    • Adrenocorticotropin receptor
    • Corticotropin receptor
    • MC2 receptor
    • MC2-R
    • MC2R
    • Melanocortin 2 receptor
    • Melanocortin 2 receptor (adrenocorticotropic hormone)
    • Melanocortin receptor 2
    see all
  • Function
    Receptor for ACTH. This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase.
  • Tissue specificity
    Melanocytes and corticoadrenal tissue.
  • Involvement in disease
    Defects in MC2R are the cause of glucocorticoid deficiency type 1 (GCCD1) [MIM:202200]; also known as familial glucocorticoid deficiency type 1 (FGD1). GCCD1 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152516 stained with Coomassie Blue.

References

ab152516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up