Description

  • Product name

    Recombinant Human MC3-R protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPT LPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAV VRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFI QHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALT LIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLF ARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLV LIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREI LCGCNGMNLG
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1 to 360

Specifications

Our Abpromise guarantee covers the use of ab132226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

    Previously labelled as MC3 Receptor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BMIQ9
    • MC3
    • MC3 R
    • MC3 Receptor
    • MC3-R
    • Mc3r
    • MC3R_HUMAN
    • Melanocortin 3 receptor
    • Melanocortin receptor 3
    • OB20
    • Obesity quantitative trait locus
    • OQTL
    see all
  • Function

    Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase.
  • Tissue specificity

    Brain, placental, and gut tissues.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132226 stained with Coomassie Blue.

References

ab132226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up