Description

  • Product name

    Recombinant Human MCAK protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGA TKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI PAPKESLRSRSTRMSTVSELRITAQENDMEVELPAAANSRKQFSVPPAPT RPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSCLVKEVEK MKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTM TDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDL TKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQT GSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVT FFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMID MGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGA DTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRD SFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLI QMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAME ELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDV IKALRLAMQLEEQASRQISSKKRPQ
    • Predicted molecular weight

      108 kDa including tags
    • Amino acids

      1 to 725

Specifications

Our Abpromise guarantee covers the use of ab132006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4930402F02Rik
    • CT139
    • ESTM5
    • KIF 2C
    • kif2c
    • KIF2C_HUMAN
    • Kinesein Family Member 2C
    • Kinesin family member 2C
    • Kinesin like 6
    • kinesin like 6 (mitotic centromere associated kinesin)
    • Kinesin like protein 6
    • Kinesin like protein KIF2C
    • Kinesin-like protein 6
    • Kinesin-like protein KIF2C
    • KNS L6
    • KNSL 6
    • KNSL6
    • MCAK
    • MGC11883
    • Mitotic centromere associated kinesin
    • Mitotic centromere-associated kinesin
    • OTTHUMP00000010066
    • X83316
    see all
  • Function

    Promotes ATP-dependent removal of tubulin dimers from microtubules. Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis.
  • Tissue specificity

    Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes, heart, brain, lung, liver, skeletal muscle, kidney or pancreas. Isoform 2 is testis-specific.
  • Sequence similarities

    Belongs to the kinesin-like protein family. MCAK/KIF2 subfamily.
    Contains 1 kinesin-motor domain.
  • Developmental stage

    Isoform 2 is expressed in fetal testis.
  • Domain

    The microtubule tip localization signal (MtLS) motif; mediates interaction with MAPRE1 and targeting to the growing microtubule plus ends.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylation by STK12, regulates association with centromeres and kinetochores and the microtubule depolymerization activity.
  • Cellular localization

    Cytoplasm > cytoskeleton. Nucleus. Chromosome > centromere. Chromosome > centromere > kinetochore. Associates with the microtubule network at the growing distal tip (the plus-end) of microtubules, probably through interaction with MTUS2/TIP150 and MAPRE1 (By similarity). Centromeric localization requires the presence of BUB1 and SGOL2.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE using ab132006 stained with Coomassie Blue.

References

ab132006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up