Description

  • Product name

    Recombinant Human MCEE protein
  • Purity

    > 90 % SDS-PAGE.
    ab99864 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMQVTGSVWNLGRLNHVAIAVPDLEKAAAFY KNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKN KAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKD CGGVLVELEQA
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      37 to 176
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.00174% PMSF, 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • DL methylmalonyl CoA racemase
    • DL-methylmalonyl-CoA racemase
    • EC 5.1.99.1
    • GLOD2
    • Glyoxalase domain containing 2
    • MCEE
    • MCEE_HUMAN
    • Methylmalonyl CoA epimerase
    • Methylmalonyl-CoA epimerase
    • methylmalonyl-CoA epimerase, mitochondrial
    • mitochondrial
    • OTTHUMP00000160122
    see all
  • Involvement in disease

    Defects in MCEE are a cause of methylmalonyl-CoA epimerase deficiency (MCEE deficiency) [MIM:251120]; also known as methylmalonyl-CoA racemase deficiency or methylmalonic aciduria type 3. MCEE deficiency is an autosomal recessive inborn error of amino acid metabolism, involving valine, threonine, isoleucine and methionine. This organic aciduria may present in the neonatal period with life-threatening metabolic acidosis, hyperammonemia, feeding difficulties, pancytopenia and coma.
  • Sequence similarities

    Belongs to the glyoxalase I family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99864 (3µg).

References

ab99864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up