Overview

  • Product name

    Recombinant Human MCJ protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAAL AFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLI LGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
    • Amino acids

      1 to 150
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as DNAJC15.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cell growth inhibiting gene 22 protein
    • Cell growth-inhibiting gene 22 protein
    • DJC15_HUMAN
    • DnaJ (Hsp40) homolog subfamily C member 15
    • DNAJ domain containing
    • DnaJ homolog subfamily C member 15
    • DNAJC15
    • DNAJD1
    • GIG22
    • HSD18
    • MCJ
    • Methylation controlled J protein
    • Methylation-controlled J protein
    see all
  • Function

    Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.
  • Tissue specificity

    Expressed at highest levels in heart, followed by liver and kidney.
  • Involvement in disease

    Absent or down-regulated in many advanced cases of ovarian adenocarcinoma, due to hypermethylation and allelic loss. Loss of expression correlates with increased resistance to antineoplastic drugs, such as cisplatin.
  • Sequence similarities

    Contains 1 J domain.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab162220 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up