Description

  • Product name

    Recombinant human MCK10/NEP (mutated S496 A) protein
    See all MCK10/NEP proteins and peptides
  • Biological activity

    The specific activity of ab204092 was determined to be 1.8 nmol/min/mg.

  • Purity

    > 75 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNP PHAAPCVPNGSAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGV TGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLK DPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDG QAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFG VTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGL YELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
    • Predicted molecular weight

      77 kDa including tags
    • Amino acids

      444 to 876
    • Modifications

      mutated S496 A
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_001954.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as MCK10

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CAK
    • CD 167
    • CD167
    • CD167 antigen-like family member A
    • CD167a
    • Cell adhesion kinase
    • DDR
    • DDR 1
    • DDR1
    • DDR1_HUMAN
    • Discoidin domain receptor
    • Discoidin domain receptor tyrosine kinase 1
    • Discoidin receptor tyrosine kinase
    • Discoidin receptor tyrosine kinase isoform a
    • EDDR 1
    • EDDR1
    • Epithelial discoidin domain receptor 1
    • Epithelial discoidin domain-containing receptor 1
    • Epithelial specific receptor kinase
    • HGK2
    • Mammarian carcinoma kinase 10
    • Mammary carcinoma kinase 10
    • MCK-10
    • MCK10
    • NEP
    • Neuroepithelial tyrosine kinase
    • Neurotrophic tyrosine kinase receptor type 4
    • NTRK 4
    • NTRK4
    • OTTHUMP00000029343
    • OTTHUMP00000029344
    • OTTHUMP00000029345
    • OTTHUMP00000029346
    • OTTHUMP00000029347
    • OTTHUMP00000164863
    • OTTHUMP00000164867
    • OTTHUMP00000222080
    • Protein-tyrosine kinase 3A
    • Protein-tyrosine kinase RTK-6
    • PTK 3
    • PTK 3A protein tyrosine kinase 3A
    • PTK3
    • PTK3A
    • Receptor tyrosine kinase NEP
    • RTK 6
    • RTK6
    • TRK E
    • TRKE
    • Tyrosine kinase DDR
    • Tyrosine kinase receptor E
    • Tyrosine-protein kinase CAK
    see all
  • Function

    May be involved in cell-cell interactions and recognition.
  • Tissue specificity

    Detected in T-47D, MDA-MB-175 and HBL-100 breast carcinoma cells, A431 epidermoid carcinoma cells, SW48 and SNU-C2B colon carcinoma cells and Hs 294T melanoma cells (at protein level). Expressed at low levels in most adult tissues and is highest in the brain, lung, placenta and kidney. Lower levels of expression are detected in melanocytes, heart, liver, skeletal muscle and pancreas. Abundant in breast carcinoma cell lines. In the colonic mucosa, expressed in epithelia but not in the connective tissue of the lamina propria. In the thyroid gland, expressed in the epithelium of the thyroid follicles. In pancreas, expressed in the islets of Langerhans cells, but not in the surrounding epithelial cells of the exocrine pancreas. In kidney, expressed in the epithelia of the distal tubules. Not expressed in connective tissue, endothelial cells, adipose tissue, muscle cells or cells of hematopoietic origin.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 1 F5/8 type C domain.
    Contains 1 protein kinase domain.
  • Domain

    The Gly/Pro-rich domains may be required for an unusual geometry of interaction with ligand or substrates.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt

Images

  • Kinase assay showing the specific activity of ab204092 as 1.8 nmol/min/mg.

  • SDS-PAGE analysis of ab204092.

References

ab204092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up