Description

  • Product name

    Recombinant Human MCK10/NEP protein (Fc Chimera His Tag)
    See all MCK10/NEP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab227394 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRA DRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTV GGLQYGGLGQLADGVVGLDDFRKSQELRYVWPGYDYVGWSNHSFSSGYVE MEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMR HNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVV NNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTALE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      21 to 417
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus (NP_054699).

Specifications

Our Abpromise guarantee covers the use of ab227394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as MCK10

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CAK
    • CD 167
    • CD167
    • CD167 antigen-like family member A
    • CD167a
    • Cell adhesion kinase
    • DDR
    • DDR 1
    • DDR1
    • DDR1_HUMAN
    • Discoidin domain receptor
    • Discoidin domain receptor tyrosine kinase 1
    • Discoidin receptor tyrosine kinase
    • Discoidin receptor tyrosine kinase isoform a
    • EDDR 1
    • EDDR1
    • Epithelial discoidin domain receptor 1
    • Epithelial discoidin domain-containing receptor 1
    • Epithelial specific receptor kinase
    • HGK2
    • Mammarian carcinoma kinase 10
    • Mammary carcinoma kinase 10
    • MCK-10
    • MCK10
    • NEP
    • Neuroepithelial tyrosine kinase
    • Neurotrophic tyrosine kinase receptor type 4
    • NTRK 4
    • NTRK4
    • OTTHUMP00000029343
    • OTTHUMP00000029344
    • OTTHUMP00000029345
    • OTTHUMP00000029346
    • OTTHUMP00000029347
    • OTTHUMP00000164863
    • OTTHUMP00000164867
    • OTTHUMP00000222080
    • Protein-tyrosine kinase 3A
    • Protein-tyrosine kinase RTK-6
    • PTK 3
    • PTK 3A protein tyrosine kinase 3A
    • PTK3
    • PTK3A
    • Receptor tyrosine kinase NEP
    • RTK 6
    • RTK6
    • TRK E
    • TRKE
    • Tyrosine kinase DDR
    • Tyrosine kinase receptor E
    • Tyrosine-protein kinase CAK
    see all
  • Function

    May be involved in cell-cell interactions and recognition.
  • Tissue specificity

    Detected in T-47D, MDA-MB-175 and HBL-100 breast carcinoma cells, A431 epidermoid carcinoma cells, SW48 and SNU-C2B colon carcinoma cells and Hs 294T melanoma cells (at protein level). Expressed at low levels in most adult tissues and is highest in the brain, lung, placenta and kidney. Lower levels of expression are detected in melanocytes, heart, liver, skeletal muscle and pancreas. Abundant in breast carcinoma cell lines. In the colonic mucosa, expressed in epithelia but not in the connective tissue of the lamina propria. In the thyroid gland, expressed in the epithelium of the thyroid follicles. In pancreas, expressed in the islets of Langerhans cells, but not in the surrounding epithelial cells of the exocrine pancreas. In kidney, expressed in the epithelia of the distal tubules. Not expressed in connective tissue, endothelial cells, adipose tissue, muscle cells or cells of hematopoietic origin.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 1 F5/8 type C domain.
    Contains 1 protein kinase domain.
  • Domain

    The Gly/Pro-rich domains may be required for an unusual geometry of interaction with ligand or substrates.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227394.

    MW: 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab227394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up