Overview

  • Product name

    Recombinant Human MCM10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADG DGESYTEEADDGETGETRDEKENLATLFGDMEDLTDEEEVPASQSTENRV LPAPAPRREKTNEELQEELRNLQEQMKALQEQLKVTTIKQTASPARLQKS PEKSPRPPLKERRVQRIQESTCFSAELDVPALPRTKRVARTPKASPPDPK SSSSRMTSAPSQPLQTISRNKPSGITRGQIVGTPGSSGETTQPICVEAFS GLRLRRPRVSSTEMNKKMTGRKLIRLSQIKEKMAREKLEEIDWVTFGVIL KKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVV GILNANPMKPKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCT QTVNLRDCEYCQYHVQAQYKKLSAKRADLQSTFSGGRIPKKFARRGTSLK ERLCQDGFYYGGVSSASYAASIAAAVAPKKKIQTTLSNLVVKGTNLIIQE TRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKP AIKSISASALLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSSR QPPAQPPRTGSEFPRLEGAPATMTPKLGRGVLEGDDVLFYDESPPPRPKL SALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEKN TMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAE MQERYFEPLVKKEQMEEKMRNIREVKCRVVTCKTCAYTHFKLLETCVSEQ HEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYKWERDGMLKEKT GPKIGGETLLPRGEEHAKFLNSLK
    • Amino acids

      1 to 874
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CNA43
    • DNA43
    • FLJ31133
    • Homolog of yeast MCM10
    • HsMCM10
    • mcm10
    • MCM10 minichromosome maintenance deficient 10
    • MCM10_HUMAN
    • Minichromosome maintenance 10 replication initiation factor
    • Minichromosome maintenance complex component 10
    • Minichromosome maintenance protein 10 isoform 1
    • PRO2249
    • Protein MCM10 homolog
    see all
  • Function

    Acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication. Additionally, plays a role in preventing DNA damage during replication.
  • Sequence similarities

    Belongs to the MCM10 family.
  • Developmental stage

    Expression is cell cycle regulated. Expression increases at the G1/S-boundary. Expression decreases in late M phase, remains low during G(1) phase, and starts to accumulate at the onset of S phase.
  • Domain

    The zinc finger-like domain binds a zinc ion and is involved in self-association.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Colocalizes with ORC2 in nuclei foci. Associated with chromatin in S phase. From early to mid-S phase located in discrete nuclear foci. In early S phase, several hundred foci appeared throughout the nucleus. In mid-S phase, the foci appeared at the nuclear periphery and nucleolar regions. In the late S and G phases localized to nucleoli.
  • Information by UniProt

Images

  • ab153397 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up