Description

  • Product name

    Recombinant Human MCM2 protein
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      YQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYH NNYDGSLNTA NGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSL SKDQQIGEKIFASIAPSIYGHE DIKRGLALALFGGEPKNPGGKHKVRG DINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQ GASAVGLTAYVQRH PVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSI SI SKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILC VVRDTVDP VQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNT YGVEPLPQEVLKKYIIYAKE RVHPKLNQMDQDKVAKMYSDLRKESMAT GSIPITVRHIESMIRMAEAHARIHLRDYVIED DVNMAIRVMLESFIDT QKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRN RFGA QQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQ F
    • Amino acids

      370 to 904

Specifications

Our Abpromise guarantee covers the use of ab92247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 108 µl aqua dest.

General Info

  • Alternative names

    • BM28
    • CCNL 1
    • CCNL1
    • CDC like 1
    • cdc19
    • CDCL 1
    • CDCL1
    • Cell devision cycle like 1
    • Cyclin like 1
    • D3S3194
    • DNA replication licensing factor MCM2
    • KIAA0030
    • MCM 2
    • MCM2
    • MCM2 minichromosome maintenance deficient 2 mitotin
    • MCM2 minichromosome maintenance deficient 2 mitotin (S. cerevisiae)
    • MCM2 minichromosome maintenance deficient 2, mitotin
    • MCM2_HUMAN
    • MGC10606
    • Minichromosome maintenance complex component 2
    • Minichromosome maintenance deficient 2 (mitotin)
    • Minichromosome maintenance deficient 2 mitotin
    • Minichromosome maintenance protein 2
    • Minichromosome maintenance protein 2 homolog
    • Mitotin
    • Nuclear protein BM28
    • OTTHUMP00000216047
    • OTTHUMP00000216050
    see all
  • Function

    Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for the entry in S phase and for cell division.
  • Sequence similarities

    Belongs to the MCM family.
    Contains 1 MCM domain.
  • Post-translational
    modifications

    Phosphorylated on Ser-108 by ATR in proliferating cells. Ser-108 proliferation is increased by genotoxic agents. Ser-40 is mediated by the CDC7-DBF4 and CDC7-DBF4B complexes, while Ser-53 phosphorylation is only mediated by the CDC7-DBF4 complex. Phosphorylation by the CDC7-DBF4 complex during G1/S phase is required for the initiation of DNA replication.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab92247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up