Overview

  • Product name

    Recombinant Human MCM5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG FTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLE EAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVK IPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTD QAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCD RYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMK KAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPI GVYTSGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKM REDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKG EDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVSALTQTQAV EGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLD AALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTK QKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK
    • Molecular weight

      106 kDa including tags
    • Amino acids

      1 to 734

Specifications

Our Abpromise guarantee covers the use of ab131918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDC 46
    • CDC46
    • CDC46 homolog
    • Cell division cycle 46
    • DNA replication licensing factor
    • DNA replication licensing factor MCM 5
    • DNA replication licensing factor MCM5
    • MCM 5
    • MCM5
    • MCM5_HUMAN
    • MGC5315
    • Minichromosome maintenance complex component 5
    • Minichromosome maintenance deficient (S. cerevisiae) 5
    • Minichromosome maintenance deficient 5
    • Minichromosome maintenance deficient protein 5
    • P1 CDC46
    • P1-CDC46
    see all
  • Sequence similarities

    Belongs to the MCM family.
    Contains 1 MCM domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab131918 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab131918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up