Description

  • Product name

    Recombinant human MCSF protein (Active)
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine M-NFS-60 cells is less than 1 ng/ml, corresponding to a specific activity of >1.0x106 IU/mg.

  • Purity

    > 95 % SDS-PAGE.
    >95% as determined by SDS-PAGE and HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYL KKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQG HERQSEGS
    • Predicted molecular weight

      37 kDa
    • Amino acids

      33 to 181

Specifications

Our Abpromise guarantee covers the use of ab243795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 micron filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at =-20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Colony stimulating factor 1
    • Colony stimulating factor 1 (macrophage)
    • Colony stimulating factor macrophage specific
    • CSF 1
    • CSF-1
    • CSF1
    • CSF1_HUMAN
    • Csfm
    • Lanimostim
    • M CSF
    • M-CSF
    • Macrophage colony stimulating factor
    • Macrophage colony stimulating factor 1
    • MCSF
    • MGC31930
    • op
    • OTTHUMP00000013364
    • OTTHUMP00000013365
    • OTTMUSP00000032803
    • OTTMUSP00000032804
    • Processed macrophage colony-stimulating factor 1
    • RP11-195M16.2
    see all
  • Function

    Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
  • Involvement in disease

    Note=Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers.
    Note=Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection.
  • Post-translational
    modifications

    N- and O-glycosylated. Glycosylation and proteolytic cleavage yield different soluble forms. One high molecular weight soluble form is a proteoglycan containing chondroitin sulfate. O-glycosylated with core 1 or possibly core 8 glycans. Isoform 1 is N- and O-glycosylated. Isoform 3 is only N-glycosylated.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab243795

References

ab243795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up