Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSIL STNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFE DQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKF IQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEA AQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVD FQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGL NLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLP RLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLC AASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQ SLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDE
    • Molecular weight
      55 kDa including tags
    • Amino acids
      20 to 512
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Activity measured by its ability to inhibit the MCSF-induced proliferation of NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is typically 1.5-8.7 pg/ml in the presence of 1 ng/ml of rhMCSF.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute ab155619 in sterile PBS to a final concentration of 100 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Avoid vigorous shaking or vortexing.

General Info

  • Alternative names
    • C FMS
    • CD 115
    • CD115
    • CD115 antigen
    • CFMS
    • Colony stimulating factor 1 receptor
    • Colony stimulating factor I receptor
    • CSF 1 R
    • CSF 1R
    • CSF-1 receptor
    • CSF-1-R
    • CSF1 R
    • CSF1R
    • CSF1R_HUMAN
    • CSFR
    • EC 2.7.10.1
    • FIM 2
    • FIM2
    • FMS
    • FMS proto oncogene
    • FMS protooncogene
    • HDLS
    • M-CSF Receptor
    • M-CSF-R
    • Macrophage colony stimulating factor 1 receptor
    • Macrophage colony stimulating factor I receptor
    • Macrophage colony-stimulating factor 1 receptor
    • McDonough feline sarcoma viral (v fms) oncogene homolog
    • MCSFR
    • Oncogen FMS
    • Proto-oncogene c-Fms
    • V-FMS McDonough feline sarcoma viral oncogen homolog, formerly
    see all
  • Function
    Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34.
  • Tissue specificity
    Expressed in bone marrow and in differentiated blood mononuclear cells.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Purity of ab155619 determined by SDS-PAGE analysis under reduced conditions and staining overnight with Coomassie Blue

References

ab155619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up