Description

  • Product name

    Recombinant Human MCSF Receptor protein (Fc Chimera)
    See all MCSF Receptor proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSIL STNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFE DQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKF IQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEA AQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVD FQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGL NLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLP RLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLC AASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQ SLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPDI EGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      20 to 517
    • Additional sequence information

      Extracellular domain with Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab215638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O.

General Info

  • Alternative names

    • C FMS
    • CD 115
    • CD115
    • CD115 antigen
    • CFMS
    • Colony stimulating factor 1 receptor
    • Colony stimulating factor I receptor
    • CSF 1 R
    • CSF 1R
    • CSF-1 receptor
    • CSF-1-R
    • CSF1 R
    • CSF1R
    • CSF1R_HUMAN
    • CSFR
    • EC 2.7.10.1
    • FIM 2
    • FIM2
    • FMS
    • FMS proto oncogene
    • FMS protooncogene
    • HDLS
    • M-CSF Receptor
    • M-CSF-R
    • Macrophage colony stimulating factor 1 receptor
    • Macrophage colony stimulating factor I receptor
    • Macrophage colony-stimulating factor 1 receptor
    • McDonough feline sarcoma viral (v fms) oncogene homolog
    • MCSFR
    • Oncogen FMS
    • Proto-oncogene c-Fms
    • V-FMS McDonough feline sarcoma viral oncogen homolog, formerly
    see all
  • Function

    Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34.
  • Tissue specificity

    Expressed in bone marrow and in differentiated blood mononuclear cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215638 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up