Recombinant human MCSF Receptor protein (Fc Chimera Active) (ab234968)

Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSIL STNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFE DQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKF IQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEA AQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVD FQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGL NLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLP RLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLC AASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQ SLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPLE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Molecular weight

      82 kDa including tags
    • Amino acids

      20 to 517
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus (NP_005202).

Specifications

Our Abpromise guarantee covers the use of ab234968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to inhibit M-CSF dependent proliferation of M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is less or equal to 100 ng/ml in the presence of 10 ng/ml M-CSF.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • C FMS
    • CD 115
    • CD115
    • CD115 antigen
    • CFMS
    • Colony stimulating factor 1 receptor
    • Colony stimulating factor I receptor
    • CSF 1 R
    • CSF 1R
    • CSF-1 receptor
    • CSF-1-R
    • CSF1 R
    • CSF1R
    • CSF1R_HUMAN
    • CSFR
    • EC 2.7.10.1
    • FIM 2
    • FIM2
    • FMS
    • FMS proto oncogene
    • FMS protooncogene
    • HDLS
    • M-CSF Receptor
    • M-CSF-R
    • Macrophage colony stimulating factor 1 receptor
    • Macrophage colony stimulating factor I receptor
    • Macrophage colony-stimulating factor 1 receptor
    • McDonough feline sarcoma viral (v fms) oncogene homolog
    • MCSFR
    • Oncogen FMS
    • Proto-oncogene c-Fms
    • V-FMS McDonough feline sarcoma viral oncogen homolog, formerly
    see all
  • Function

    Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34.
  • Tissue specificity

    Expressed in bone marrow and in differentiated blood mononuclear cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab234968.

    MW: 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab234968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up