Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPR RDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTIS FSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
    • Molecular weight

      41 kDa including tags
    • Amino acids

      19 to 160
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ESOP 1
    • ESOP-1
    • ESOP1
    • LY 96
    • Ly-96
    • LY96
    • LY96_HUMAN
    • Lymphocyte antigen 96
    • md 2
    • MD 2 protein
    • MD2 protein
    • Myeloid differentiation protein 2
    • Protein MD 2
    • Protein MD-2
    • Protein MD2
    see all
  • Function

    Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both MD2 and TLR4, but not TLR4 alone, respond to LPS.
  • Post-translational
    modifications

    N-glycosylated; high-mannose.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132303.

References

ab132303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up