Description

  • Product name

    Recombinant human MDC protein
    See all MDC proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC analysis.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKE ICADPRVPWVKMILNKLSQ
    • Predicted molecular weight

      8 kDa
    • Amino acids

      25 to 93
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 93. The signal peptide is included. Single, non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab202800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 2.9% Sodium chloride, 97% Phosphate Buffer

    Lyophilised from a 0.2 µm filtered concentrated solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • A 152E5.1
    • ABCD 1
    • ABCD1
    • C C motif chemokine 22
    • CC chemokine STCP 1
    • CC chemokine STCP-1
    • ccl 22
    • Ccl22
    • CCL22_HUMAN
    • Chemokine (C C motif) ligand 22
    • DC/B CK
    • DCBCK
    • Macrophage-derived chemokine
    • MDC
    • MDC(1-69)
    • MDC(7-69)
    • MGC34554
    • SCYA22
    • Small inducible cytokine subfamily A (Cys Cys) member 22
    • Small inducible cytokine subfamily A, member 22
    • Small-inducible cytokine A22
    • STCP 1
    • STCP1
    • Stimulated T cell chemotactic protein 1
    • Stimulated T-cell chemotactic protein 1
    see all
  • Function

    May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active.
  • Tissue specificity

    Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression in small intestine. In lymph node expressed in a mature subset of Langerhans' cells (CD1a+ and CD83+). Expressed in Langerhans' cell histiocytosis but not in dermatopathic lymphadenopathy. Expressed in atopic dermatitis, allergic contact dermatitis skin, and psoriasis, in both the epidermis and dermis.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    The N-terminal processed forms MDC(3-69), MDC(5-69) and MDC(7-69) are produced by proteolytic cleavage after secretion from monocyte derived dendrocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up