Recombinant Human MDC protein (Fc Chimera) (ab216177)
Key features and details
- Expression system: CHO cells
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 0.060 Eu/µg
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human MDC protein (Fc Chimera)
See all MDC proteins and peptides -
Purity
> 98 % SDS-PAGE. -
Endotoxin level
< 0.060 Eu/µg -
Expression system
CHO cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKE ICADPRVPWVKMILNKLSQ -
Predicted molecular weight
11 kDa -
Amino acids
25 to 93 -
Additional sequence information
Fused to the N-terminus of the Fc region of human IgG1. NCBI Accession No. AAH27952.1.
-
Specifications
Our Abpromise guarantee covers the use of ab216177 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at +4°C. Avoid freeze / thaw cycle.
Constituent: 100% PBS
0.2 µm-filtered solution. -
ReconstitutionReconstitute 10 µg vial in 100 µL sterile water. Add 1X PBS to the desired protein concentration. Stable for at least 1 year after receipt when stored at -20°C. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- A 152E5.1
- ABCD 1
- ABCD1
see all -
Function
May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active. -
Tissue specificity
Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression in small intestine. In lymph node expressed in a mature subset of Langerhans' cells (CD1a+ and CD83+). Expressed in Langerhans' cell histiocytosis but not in dermatopathic lymphadenopathy. Expressed in atopic dermatitis, allergic contact dermatitis skin, and psoriasis, in both the epidermis and dermis. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsThe N-terminal processed forms MDC(3-69), MDC(5-69) and MDC(7-69) are produced by proteolytic cleavage after secretion from monocyte derived dendrocytes. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab216177 has not yet been referenced specifically in any publications.