Description

  • Product name

    Recombinant Human MDC protein (Fc Chimera)
    See all MDC proteins and peptides
  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKE ICADPRVPWVKMILNKLSQ
    • Predicted molecular weight

      11 kDa
    • Amino acids

      25 to 93
    • Additional sequence information

      Fused to the N-terminus of the Fc region of human IgG1. NCBI Accession No. AAH27952.1.

Specifications

Our Abpromise guarantee covers the use of ab216177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at +4°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute 10 µg vial in 100 µL sterile water. Add 1X PBS to the desired protein concentration. Stable for at least 1 year after receipt when stored at -20°C. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • A 152E5.1
    • ABCD 1
    • ABCD1
    • C C motif chemokine 22
    • CC chemokine STCP 1
    • CC chemokine STCP-1
    • ccl 22
    • Ccl22
    • CCL22_HUMAN
    • Chemokine (C C motif) ligand 22
    • DC/B CK
    • DCBCK
    • Macrophage-derived chemokine
    • MDC
    • MDC(1-69)
    • MDC(7-69)
    • MGC34554
    • SCYA22
    • Small inducible cytokine subfamily A (Cys Cys) member 22
    • Small inducible cytokine subfamily A, member 22
    • Small-inducible cytokine A22
    • STCP 1
    • STCP1
    • Stimulated T cell chemotactic protein 1
    • Stimulated T-cell chemotactic protein 1
    see all
  • Function

    May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active.
  • Tissue specificity

    Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression in small intestine. In lymph node expressed in a mature subset of Langerhans' cells (CD1a+ and CD83+). Expressed in Langerhans' cell histiocytosis but not in dermatopathic lymphadenopathy. Expressed in atopic dermatitis, allergic contact dermatitis skin, and psoriasis, in both the epidermis and dermis.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    The N-terminal processed forms MDC(3-69), MDC(5-69) and MDC(7-69) are produced by proteolytic cleavage after secretion from monocyte derived dendrocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab216177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up