Description

  • Product name

    Recombinant Human MDH2 protein
    See all MDH2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETK AAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATL TAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDI VRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLT ALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVE CSFVKSQETECTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELK ASIKKGEDFVKTLKVDHHHHHH
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      25 to 338
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 338. The transit peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab199589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

General Info

  • Alternative names

    • M MDH
    • Malate dehydrogenase
    • Malate dehydrogenase 2, NAD (mitochondrial)
    • Malate dehydrogenase, mitochondrial
    • MDH
    • mdh2
    • MDHM_HUMAN
    • MGC:3559
    • mitochondrial
    • Mitochondrial malate dehydrogenase 2, NAD
    • Mor 1
    • MOR1
    see all
  • Sequence similarities

    Belongs to the LDH/MDH superfamily. MDH type 1 family.
  • Post-translational
    modifications

    Acetylation is enhanced by up to 67% after treatment either with trichostin A (TSA) or with nicotinamide (NAM) with the appearance of tri-and tetraacetylations. Glucose also increases acetylation by about 60%.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

References

ab199589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up