Description

  • Product name

    Recombinant Human MDP1 protein
    See all MDP1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab101631 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVD PPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEG ANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERR NIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 176
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • FN6Pase
    • Fructosamine-6-phosphatase
    • Magnesium dependent phosphatase 1
    • Magnesium-dependent phosphatase 1
    • MDP 1
    • MDP-1
    • Mdp1
    • MGDP1_HUMAN
    see all
  • Function

    Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
  • Sequence similarities

    Belongs to the HAD-like hydrolase superfamily.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab101631.

References

ab101631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up