Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE VPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSK ITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTL SQGLETFAKAQTGPLRSSLEESPFEAVDHHHHHH
    • Molecular weight

      21 kDa including tags
    • Amino acids

      1 to 176
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab196079 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 7.50
    Constituents: 0.87% Sodium chloride, 10% Glycerol, 89% Tris HCl

    0.2 µM filtered solution

General Info

  • Alternative names

    • FN6Pase
    • Fructosamine-6-phosphatase
    • Magnesium dependent phosphatase 1
    • Magnesium-dependent phosphatase 1
    • MDP 1
    • MDP-1
    • Mdp1
    • MGDP1_HUMAN
    see all
  • Function

    Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
  • Sequence similarities

    Belongs to the HAD-like hydrolase superfamily.
  • Information by UniProt

References

ab196079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up