Overview

  • Product name

    Recombinant Human ME1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNS QEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPI VYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVV TDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENE ELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANV NAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQE KEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNER PIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPG QGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLY PPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYD QILPDCYSWPEEVQKIQTKVDQ
    • Molecular weight

      89 kDa including tags
    • Amino acids

      1 to 572

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cytosolic malic enzyme 1
    • HUMNDME
    • Malate dehydrogenase
    • Malic enzyme 1
    • Malic enzyme 1, NADP(+) dependent, cytosolic
    • Malic enzyme 1, soluble
    • Malic enzyme, cytoplasmic
    • MAOX_HUMAN
    • ME1
    • MES
    • NADP dependent malic enzyme
    • NADP ME
    • NADP-dependent malic enzyme
    • NADP-ME
    • Pyruvic malic carboxylase
    see all
  • Tissue specificity

    Expressed in all tissues tested including liver, placenta and white adipose tissue.
  • Sequence similarities

    Belongs to the malic enzymes family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152518 stained with Coomassie Blue.

References

ab152518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up